PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000131659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 156aa    MW: 17866.7 Da    PI: 7.9657
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000131659genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.7e-0972115346
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkv 46 
                    k+ ++t++qle Le+ Fe++ +++  ++ +L+++lgL+ rq+ v
  MDP0000131659  72 KKKRLTSDQLESLERSFEEEIKLDPVRKMKLSRELGLQPRQIAV 115
                    56679************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-855115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-1057115IPR009057Homeodomain-like
SMARTSM003890.001569129IPR001356Homeobox domain
PfamPF000461.6E-672115IPR001356Homeobox domain
CDDcd000864.54E-772115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MDWKTSLRHL VSRPEPSSGF LYNYNCYDHY SPGMEMKHQA MISETSSKGG LVPGLMDRNN  60
HQSGYGCSSQ DKKKRLTSDQ LESLERSFEE EIKLDPVRKM KLSRELGLQP RQIAVCANKA  120
GGKNQHQIAE CNYLXINIEE YNPVSPPFWG NXPFYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392605.12e-80PREDICTED: uncharacterized protein LOC103454782
TrEMBLA0A067JZ674e-41A0A067JZ67_JATCU; Uncharacterized protein
STRINGPOPTR_0006s11890.11e-34(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33943466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.13e-18homeobox 51